Dissertation > Excellent graduate degree dissertation topics show

Ⅰ.Structure and Function Study of Lystoxin Ⅱ:a Cytotoxic Peptide from the Wolf Spider Lycosa Singoriensis Venom Ⅱ.Extablishment of a Method Combined Oocyte Microinjection with Electrophysiological Recording

Author: DaiLongJun
Tutor: XieJinYun;LiangSongPing
School: Hunan Normal University
Course: Biochemistry and Molecular Biology
Keywords: Lycosa singoriensis cytotoxic peptide lystoxinⅡ Xenopus oocytes two electrode voltage clamp
CLC: Q51-3
Type: Master's thesis
Year: 2006
Downloads: 19
Quote: 0
Read: Download Dissertation

Abstract


A novel cationic cytotoxic peptide with an average molecular mass of 7335.35 Da was isolated from the venom of Lycosa singoriensis, and was denoted lystoxin II. The sequence of lystoxin II was determined by Edman degradation and RACE method: KECIPKHHECTSNKHGCCRGNFFKYKCQCTTVVTQDGEQTERCFCGTPPHHK AAELVVGFGKKIF-NH2. The toxin contains 65 residues and possesses an amidated phenylalanine-residue at C-terminal. The theoretical pI of the cationic peptide is 8.69. The eight cysteins of lystoxin II are highly conserved compared with CSTX-1 and CSTX-9, indicating that lystoxin II might take the same disulfide bridge pattern as CSTX-1: C1-C4, C2-C5, C3-C8 and C6-C7 . This arrangement belongs to the inhibitor cystine knot (ICK) structural motif . Lystoxin II induced rapid leak currents in Xenopus laevis oocytes at a concentration of 50μM. Haemolytic assays of lystoxin II on human erythrocytes showed that lystoxin II induced 42% haemolysis at a concentration of 100μM. In MTT assay against Hela cells, the IC50 value was 22.0μmol/L. LystoxinⅡhas no effect on Gram-positive and Gram-negative bacteria and fungi at a concentration of 50μM. PartⅡ. Establishment of a method combined oocyte microinjection with electrophysiological recordingThe capacity of the Xenopus oocytes to translate efficiently and faithfully foreign genetic information combined with its ability to assemble oligomeric receptor/channel complexes and insert them into the plasma membrane to generate excitable electrophysiological responses makes them a powerful tool for the molecular neurobiologist. Xenopus oocyte microinjection has already led to the heterologous expression of numerous ion channels, pumps, and receptors, and the cloning and characterization of the genes encoding them. Oocytes are injected with mRNAs extracted from tissues or synthesized in vitro from cloned cDNAs, after which the foreign mRNAs are translated by the oocyte’s own protein-synthesizing machinery, and the products are processed and incorporated into the oocyte plasma membrane. Using this method, oocytes have been induced to acquire many known neurotransmitter receptors and voltage-activated ion channels.Once expressed in the large oocyte cells (over 1mm in diameter), these receptors and ion channels may be studied with electrophysiological and biochemical techniques in a way much easier than using neuronal cells. We establish this method combined oocyte mieroinjection with electrophysiological recording to further our insight into the effect of toxins on subtype of ion channel expressed in oocyte.

Related Dissertations

  1. Functional Analysis of a Phosphate Transporter Gene OsPtl in Rice,S511
  2. Characteristics of membrane current induced by diverse types of excitory amino acide receptors The mutual influence of membrane current induced by receptors with diverse coupling mode in Xenopus oocytes,R965
  3. Study of EGF-induced Regulation of Delayed Rectifier Potassium Currents,R96
  4. Characteristics of the ATP-activated Current and Its Modulation in Xenopus Oocytes,Q26
  5. Study on Molecular Mechanism of Novel 4-amino Pepidine Derivatives on N-type Ca~(2+) Channels,R96
  6. CLONING OF CLC-1 CHLORIDE CHANNEL ISOFORMS AND THE RELATED ELECTROPHYSIOLOGICAL STUDY OF THE CHANNEL PROPERTIES,Q785
  7. The Elective Toxic Effect of One Component Separated from Cobra Snake Venom on the Neuronal Cell and Its Possible Mechanisms,Q51
  8. Research on Predicting Intrinsic Disorder Protein Structure Based on Supervision Manifold Learning Algorithm,Q51
  9. Functional Study of Active Sites in Scorpion Insect Toxin BmK IT from Buthus Martensii Karsch,Q51
  10. The Physico-chemical Property and Functional Investigation of the C-terminal E Peptide of Mechano Growth Factor,Q51
  11. Effect of the Sencond Domain Deletion on the Interaction between Yelp3 and Elp4 and Other Proteins,Q51
  12. Studies on Protein Molecular Surface and Its Electrostatic Energy,Q51
  13. Structure and substrate of type III effector protein HopU1 GRP7 the ADP ribosylation,Q51
  14. Research on Prediction of Protein-Protein Interactions Based Maximum Entropy Clustering Algorithm,Q51
  15. Research on Feature Extraction Algorithm and Dataset Construction Technology in Membrane Protein Classification,Q51
  16. Studies on the Binding of Heavy Metal Cd2+、Zn2+ to Transferrin by Using Square Wave Voltammetry,Q51
  17. Statistical Inference for Protein Families and Folds Based on Database,Q51
  18. Prediction of Protein-protein Interaction and DNA Methylation Sites Based on Increment of Diversity Combined with Quadratic Discriminant Analysis,Q51
  19. Regeneration and Preparation of IMAC Proteinchip,Q51
  20. Detection of Proteins Information Based on Wavelet and Fuzzy Relationship,Q51
  21. Studies on Structured Storage and Compression of Mass Spectrometry Data,Q51
  22. Structural Insights into the Molecular Mechanism of Formate Transporter FocA Functioning,Q51

CLC: > Biological Sciences > Biochemistry > Protein
© 2012 www.DissertationTopic.Net  Mobile