Dissertation > Excellent graduate degree dissertation topics show

The Purification and Isolation of Antimicrobial Peptides from the Grass Carp Intestine and the Research on Physicochemical Properties

Author: HuangPing
Tutor: ZhangHuaiYun
School: Central South University of Forestry Science and Technology
Course: Biochemistry and Molecular Biology
Keywords: Intestine antimicrobial peptide RP-HPLC Antimicrobial Activity Grass Carp
CLC: S917.4
Type: Master's thesis
Year: 2009
Downloads: 74
Quote: 0
Read: Download Dissertation

Abstract


Antimicrobial peptide is an important part of innate immunity systems, it is the non-specific immunity, can be rapidly synthesized, to resist the proliferation of pathogenic microbes. The speed of its response to specific immune system is unparalleled. So it can play important roles in Prevention and treatment of disease harm to fish and improved varieties. The small intestine of grass carp may possess one or more antimicrobial peptides. The study is that applying SepadexLH-20 size exclusion and RP-HPLC purify the antimicrobial peptide from grass carp. Ulteriorly we research the biological function and physicochemical properties.1. The isolation and purification of antimicrobial peptide from grass carp intestine.After the fresh small intestines of grass carp were treated by grinding, ultrasonic treatment, and 5% acetic acid extraction antimicrobial peptides was isolated from small intestines of grass carp by SephadexLH-20 gel filtration chromatography and RP-HPLC. The fractions obtained were tested against Eseherichia.coli. The fractions showing the antimicrobial activity underwent further characterization. Via changing the condition of the RP-HPLC, the fraction of the first RP-HPLC was purified again, the collection was lyophilized and stored 4℃.2. The research on the antimicrobial activity and the physicochemical propertiesUsing slip diffusion assay, its antimicrobial activity against 7 bacteria strains (pathogenic Escherichia coli、pathogenic Staphyloccocus aureus、Streptococcus、Aeromonas Hydrophila、Myxococcus piscicola、Salmonella、Pasteurella) was researched. The result shows that the intestine antimicrobial peptide was strongly active against all the bacteria strains above Staphyloccocus aureus. The results preliminarily indicated that the small intestine antimicrobial peptide was strongly active against bacteria and possessed broad antimicrobial spectrum.Using different temperatures incubating the intestine antimicrobial peptides 30mins, its antimicrobial activity was tested by Escherichia coli. The result shows that after high temperature incubating, the activity of antimicrobial peptide was not changed. The result revealed that the grass carp intestine antimicrobial peptide had thermal stability.Using trypsin digesting the antimicrobial peptide 16 h, at 37℃, the recovery of the antimicrobial peptide by RP-HPLC was tested antimicrobial activity. The results show that the retention time of the antimicrobial peptide in RP-HPLC system and the antimicrobial activity were not changed. The result indicated that the antimicrobial peptide may be lack of lysine or arginine in primary structure or the antimicrobial peptide had anti-trypsin digesting characteristic.Morphological observation of pathogenic Escherichia coli、pathogenic Staphyloccocus aureus、Aeromonas Hydrophila treated with the small intestine antimicrobial peptide, respectively at 37℃for 30 minutes under scanning electron microscopy (SEM) showed that the surfaces of the tested bacteria above became considerably rough, erimpled, shriveled, distorted and blebbed. The results provided conclusive evidence that the small intestine antimicrobial peptide was membrane active.3. The analysis of the N-residue amnio acid of antimicrobial peptide from grass carpUsing GlycoProTM Enzymatic Deglycosylation Kit treated antimicrobial peptide and recovering the digesting product by RP-HPLC, the product was analyzed MALDI-TOF-MS, the molecular weight was 2762 Da, the product was analyzed by automated Edman degradation sequencing. We obtained a 30 residues amino acid sequence (VKGLVGFAGRRGPPGPRGPVGPAGAKGHQG), this sequence was predicted and analyzed by online bioinformatics database (APDatabase).

Related Dissertations

  1. cDNA Cloning, Expression of vp5 and vp7 Genes and Subcecullar Localization of VP5 and VP7 Proteins in Grass Carp Reovirus,S941.41
  2. Determination Method and Extraction Purification of Terpenoid Indole Alkaloids in Catharanthus Roseus,R284
  3. Dalian Sea Screening and Identification of culturable marine actinomycetes,Q93
  4. RP-HPLC Method for Lipophilicity Measurement of Compounds,O656.2
  5. Purification and Analgesic Activity of CTXn from Naja Naja Atra Venom,R96
  6. RP-HPLC of different cyclodextrin derivatives with cilostazol inclusion studies,R914
  7. Preliminary Study on Anti-tumor Effect of Sinapine on H22 Mice Hepatocellular Carcinoma and Its Mechanisms,R735.7
  8. Establishment of Quality Standard and Fingerprint Chromatograph of Ipomoea Batatas (L.) Lam. Simon No.1,R284
  9. Study on Antioxidative Peptide of Peanut Meal,TS229
  10. The Extraction and Purification of Tea Saponin and the Extraction of Tea Seed Polysaccharide in Camellia Cake,S571.1
  11. The Experimentation on a New Saponin for Its Extraction Separation from Homonoia Riparia Lour and the Effects on Hyperuricemia,R965
  12. Studies on Biopharmaceutical Analysis and Preclinical Pharmacokinetics of a Compound Preparation: Amlodipine and Telmisartan,R96
  13. The Study of Rapeseed Protein ACE Inhibitory Preparation and Seperated,TQ464.7
  14. The Toxicity of Abamectin Effects on Macrobrachium Nipponense and the Pharmacokinetics in MacrobrachiumNipponense,S948
  15. Pharmacokinetic and Bioequivalent Studies of Lansoprazole Tablets in Healthy Body,R96
  16. A Pre-Column Derivatization RP-HPLC Method for Determination of Panoxadiol and Panaxatriol in the Cosmetics,TQ658
  17. Determination of Higenamine by Reversed Phase High Performance Liquid Chromatography with Precolumn Derivatization,O657.72
  18. Effects of Xylooligosaccharide on the Non-Specific Immunity Function and the Expression of Immune Related Genes on Ctenopharyngodon Idellus,S963.1
  19. Purification and Pharmacological Activity of CTX1 from Naja Naja Cantor Venom,R285
  20. Studies on the Analytical Method of Major Proteins and 17 Kinds of β-Agonists in Milk,TS252.7

CLC: > Agricultural Sciences > Aquaculture, fisheries > Aquatic basic science > Aquatic Biology > Aquatic Zoology
© 2012 www.DissertationTopic.Net  Mobile